PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0061700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 344aa    MW: 37379 Da    PI: 6.0836
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0061700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd+++v +v  +G g+W++++++ g++R++k+c++rw +yl
   Spipo2G0061700 14 RGLWTAEEDKKIVAYVSTHGAGNWASVPKKAGLKRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding41.14.1e-1369110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +T+ E++ ++ ++ + G++ W+ Ia+ ++ gRt++++k++w++
   Spipo2G0061700  69 DFTPGEEQTIISLHSKIGSR-WSIIAHQLP-GRTDNDVKNYWNT 110
                      69******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.486965IPR017930Myb domain
SuperFamilySSF466891.39E-2911108IPR009057Homeodomain-like
SMARTSM007172.2E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001673.66E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2365117IPR009057Homeodomain-like
SMARTSM007175.6E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129417.52566116IPR017930Myb domain
PfamPF002493.7E-1269110IPR001005SANT/Myb domain
CDDcd001673.95E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRPPCCDKS NVRRGLWTAE EDKKIVAYVS THGAGNWASV PKKAGLKRCG KSCRLRWTNY  60
LRPDLKHDDF TPGEEQTIIS LHSKIGSRWS IIAHQLPGRT DNDVKNYWNT KLKKKLIQRG  120
IDPVTHRPIS HVVNSIQGLS RACDGDVEVN MAACQIQKDP RVGCLGRDHN HAFGPVPEST  180
PDLAETAMAE QEAASYSCKP AWDLLAQLHA VKLVADATVE GLTTPLTFSH NLPGSAPSPS  240
SFSLTPETIG GAPSDFSWTD LIPQGDLPTF PFAEAPPIRG KLHGEGGEIC GGARTTLGED  300
DGEDHRGASS SSDINSFVES LLSRDDEMMW AFPEFLDDPF VCP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25141167108B-MYB
1mse_C4e-25141164105C-Myb DNA-Binding Domain
1msf_C4e-25141164105C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264963.12e-90PREDICTED: transcription factor MYB76
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118743439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.17e-71MYB family protein